CRAMP 1-39 peptide

Name		CRAMP 1-39
Synonyms		mCRAMP, MCLP
Sequence		ISRLAGLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
3-letter-code		Ile - Ser - Arg - Leu - Ala - Gly - Leu - Leu - Arg - Lys - Gly - Gly - Glu - Lys - Ile - Gly - Glu - Lys - Leu - Lys - Lys - Ile - Gly - Gln - Lys - Ile - Lys - Asn - Phe - Phe - Gln - Lys - Leu - Val - Pro - Gln - Pro - Glu - Gln
Molecular weight		4419.33
Counter ion		TFA
Solubilization		Soluble in pure water.
Description		The anti-microbial peptide CRAMP corresponds to aa 135-173 of the mouse cathelicidin like protein (MCLP).
References		P. Bergman, L. Johansson, H. Wan, A. Jones, R. L. Gallo, G. H. Gudmundsson, T. H�kfelt, A-B Jonsson, and B. Agerberth Induction of the Antimicrobial Peptide CRAMP in the Blood-Brain Barrier and Meninges after Meningococcal Infection Infect Immun. 2006;74(12):6982�6991. M. Chromek, Z. Slamov�1, P. Bergman, L. Kov�cs, L. Podrack�, I. Ehr�n, T. H�kfelt, G.H. Gudmundsson, R. L. Gallo, B. Agerberth & A. Brauner. 2006. The antimicrobial peptide cathelicidin protects the urinary tract against invasive bacterial infection. Nature Medicine - 12, 636-641.